PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G36740.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 959aa    MW: 104554 Da    PI: 5.1719
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G36740.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.4e-41151228178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC+adl+ +++yhrrhkvCe+h+ka++++v ++ qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  OMERI03G36740.2 151 ACQVEGCTADLTGVRDYHRRHKVCEMHAKATTAVVGNTVQRFCQQCSRFHPLQEFDEGKRSCRRRLAGHNRRRRKTRP 228
                      5**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.3E-34145213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-38150230IPR004333Transcription factor, SBP-box
PfamPF031101.6E-30152225IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.02E-8740846IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.1E-7743849IPR020683Ankyrin repeat-containing domain
CDDcd002049.20E-9746846No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 959 aa     Download sequence    Send to blast
MEAARVGAQS RHLYGGGLGE PDMDRRDKRL FGWDLNDWRW DSDRFVATPV PTAEASGLAL  60
NSSPSSSEEA GAALVRNVNA RGDSDKRKRV VVIDDDDVED DELVENGGGS LSLRIGGDAV  120
ANGAGVGGGA DEEDRNGKKI RVQGGSPSGP ACQVEGCTAD LTGVRDYHRR HKVCEMHAKA  180
TTAVVGNTVQ RFCQQCSRFH PLQEFDEGKR SCRRRLAGHN RRRRKTRPEV AVGGSAFTED  240
KDSTIVLAAD TAEHLRGQEL LSGLLRNLGA VAKSLDPKEL CKLLEACQSM QDGSNAGTSE  300
TANALVNTAV AEAAGPSNSK MPFVNGDQCG LASSSVVPVQ SKSPTVATPD PPACKFKDFD  360
LNDTCGGMEG FEDGYEGSPT PAFKTTDSPN CPSWMHQDST QSPPQTSGNS DSTSAQSLSS  420
SNGDAQCRTD KIVFKLFEKV PSDLPPVLRS QILGWLSSSP TDIESYIRPG CIILTVYLRL  480
VEPAWKELSD NMSSYLDKLL NSSTGNFWAS GLVFVMVRHQ IAFMHNGQLM LDRPLANSAH  540
HYCKILCVRP IAAPFSTKVN FRVEGLNLVS DSSRLICSFE GSCIFQEDTD NIVDDAEHDD  600
IEYLNFCCPL PSSRGRGFVE VEDGGFSNGF FPFIIAEQDI CSEVCELESI FESSSHEQAD  660
DDNARNQALE FLNELGWLLH RANIISKQNK VPLASFNIWR FRNLGIFAME REWCAVTKLL  720
LDFLFIGLVD IGSQSPEEVV LSENLLHAAV RMKSAQMVRF LLGYKPNESL KGTAETFLFR  780
PDAQGPSKFT PLHIAAATDD AEDVLDALTN DPGLVGINVW RNARDDAGFT PEDYARQRGN  840
DAYLNMVEKK INKHLGKGHV VLGVPSSIHP VITDGVKPGE VSLEIGMSVP PPAPRCNACS  900
RQALMYPNSM ARTFLYRPAM LTVMGIAVIC VCVGLLLHTC PKVYAAPTFR WELLERGPM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-31145225484squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0721640.0AK072164.1 Oryza sativa Japonica Group cDNA clone:J013130O11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631511.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
SwissprotQ75LH60.0SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLA0A0E0D9580.0A0A0E0D958_9ORYZ; Uncharacterized protein
STRINGORGLA03G0367800.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1